ICA1 Antikörper (Middle Region)
-
- Target Alle ICA1 Antikörper anzeigen
- ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))
-
Bindungsspezifität
- AA 243-276, Middle Region
-
Reaktivität
- Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ICA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- EKTSHTMAAI HESFKGYQPY EFTTLKSLQD PMKK
- Kreuzreaktivität (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Produktmerkmale
-
Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: islet cell autoantigen 1, 69 kDa
Protein Name: Islet cell autoantigen 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product ICA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))
- Andere Bezeichnung
- ICA1 (ICA1 Produkte)
- Synonyme
- ica1 antikoerper, MGC52730 antikoerper, ICA1 antikoerper, DKFZp469G0321 antikoerper, zgc:92566 antikoerper, 69kDa antikoerper, ICA69 antikoerper, Ica69 antikoerper, MGC83241 antikoerper, ICAp69 antikoerper, islet cell autoantigen 1 L homeolog antikoerper, islet cell autoantigen 1 antikoerper, Islet cell autoantigen 1 antikoerper, islet cell autoantigen 1 S homeolog antikoerper, ica1.L antikoerper, ICA1 antikoerper, ica1 antikoerper, ica69 antikoerper, Ica1 antikoerper, ica1.S antikoerper
- Hintergrund
-
Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What's more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.
Synonyms: 69 kDa islet cell autoantigen antibody|Diabetes mellitus type I autoantigen antibody|ICA 1 antibody|Ica1 antibody|ICA69 antibody|ICA69_HUMAN antibody|ICAp69 antibody|Islet cell autoantigen 1 (69kD) antibody|Islet cell autoantigen 1 69 kDa antibody|Islet cell autoantigen 1 antibody|Islet cell autoantigen 1 isoform antibody|Islet cell autoantigen p69 antibody|OTTHUMP00000200933 antibody|OTTHUMP00000200934 antibody|OTTHUMP00000200941 antibody|OTTHUMP00000200993 antibody|p69 antibody - Gen-ID
- 3382
- UniProt
- Q05084
-