FUT1 Antikörper (N-Term)
-
- Target Alle FUT1 Antikörper anzeigen
- FUT1 (Fucosyltransferase 1 (Galactoside 2-alpha-L-Fucosyltransferase, H Blood Group) (FUT1))
-
Bindungsspezifität
- AA 134-164, N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FUT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Galactoside 2-alpha-L-fucosyltransferase 1(FUT1) detection. Tested with WB, IHC-P in Human,Mouse, Rat.
- Sequenz
- EVDSRTPWRE LQLHDWMSEE YADLRDPFLK L
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Galactoside 2-alpha-L-fucosyltransferase 1(FUT1) detection. Tested with WB, IHC-P in Human,Mouse, Rat.
Gene Name: fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
Protein Name: Galactoside 2-alpha-L-fucosyltransferase 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL), different from the related mouse and rat sequences by seven amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product FUT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- FUT1 (Fucosyltransferase 1 (Galactoside 2-alpha-L-Fucosyltransferase, H Blood Group) (FUT1))
- Andere Bezeichnung
- FUT1 (FUT1 Produkte)
- Synonyme
- Futa antikoerper, H antikoerper, HH antikoerper, HSC antikoerper, Fut1 antikoerper, fucosyltransferase 1 antikoerper, fucosyltransferase 1 (H blood group) antikoerper, Fut1 antikoerper, FUT1 antikoerper
- Hintergrund
-
Galactoside 2-alpha-L-fucosyltransferase 1 is an enzyme that in humans is encoded by the FUT1 gene. It is mapped to 19q13.3. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
Synonyms: 2)FT 1 antibody|2-alpha-L-fucosyltransferase antibody|Alpha (1 2) fucosyltransferase antibody|Alpha(1 2)FT 1 antibody|Alpha(1 antibody|Blood group H alpha 2-fucosyltransferase antibody|fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase) antibody| Fucosyltransferase 1 antibody|FUT1 antibody|FUT1_HUMAN antibody|Galactoside 2 alpha L fucosyltransferase antibody|Galactoside 2-alpha-L-fucosyltransferase 1 antibody|GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1 antibody|H antibody|HH antibody| HSC antibody|Para Bombay phenotype antibody - Gen-ID
- 2523
- UniProt
- P19526
-