Complexin 1, 2 (AA 45-81) Antikörper

Produktnummer ABIN1742265

Produktdetails

Target: Complexin 1, 2

Bindungsspezifität: AA 45-81

Reaktivität: Maus, Ratte, Human, Rind (Kuh), Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Immunocytochemistry (ICC), Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)

Spezifität: Recognizes complexin 1 and 2.

Aufreinigung: antiserum

Immunogen: Synthetic peptide EEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAE (aa 45-81 in complexin 2) coupled to key-hole limpet hemocyanin via an added N-terminal cysteine residue. Immunogen is located inside the mapped binding domain of complexin 2 to the SNARE complex (aa 41 - 91).

Anwendungsinformationen

Applikationshinweise: WB: 1 : 1000 up to 1 : 20000 (AP staining)
ICC: 1 : 200 up to 1 : 500

Kommentare:

IP: Co-immunoprecipitates the SNARE complex.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Buffer: PBS

Handhabung: Crude antisera are more robust than monoclonals. With anti-microbials added, they may be stored at 4 °C.
Serum does not contain active proteases, in fact, serum itself contains a powerful cocktail of protease inhibitors. Frozen storage (-20 °C),however, is preferable.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Unlabeled antibodies are stable in this form without loss of quality at ambient temperatures for several weeks or even months. They can be stored at 4 °C for several years.

Referenzen

Getz, Visser, Bell, Xu, Flynn, Zaidi, Syed: "Two proteolytic fragments of menin coordinate the nuclear transcription and postsynaptic clustering of neurotransmitter receptors during synaptogenesis between Lymnaea neurons." in: Scientific reports, Vol. 6, pp. 31779, (2016) (PubMed).

Wilhelm, Mandad, Truckenbrodt, Kröhnert, Schäfer, Rammner, Koo, Claßen, Krauss, Haucke, Urlaub, Rizzoli: "Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins." in: Science (New York, N.Y.), Vol. 344, Issue 6187, pp. 1023-8, (2014) (PubMed).

Tsai, Brewis, van Maaren, Gadella: "Involvement of complexin 2 in docking, locking and unlocking of different SNARE complexes during sperm capacitation and induced acrosomal exocytosis." in: PLoS ONE, Vol. 7, Issue 3, pp. e32603, (2012) (PubMed).

Lee, Brecha: "Immunocytochemical evidence for SNARE protein-dependent transmitter release from guinea pig horizontal cells." in: The European journal of neuroscience, Vol. 31, Issue 8, pp. 1388-401, (2010) (PubMed).

Falkowski, Thomas, Groblewski: "Complexin 2 modulates vesicle-associated membrane protein (VAMP) 2-regulated zymogen granule exocytosis in pancreatic acini." in: The Journal of biological chemistry, Vol. 285, Issue 46, pp. 35558-66, (2010) (PubMed).

Antigendetails

Target: Complexin 1, 2

Hintergrund: Synonyms: Synaphin 2,1, CPX 1, CPX 2