anti-Maus UGGT1 Antikörper für Immunofluorescence

Recommended UGGT1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1) Antikörper
  • UGCGL1
  • ugcgl1
  • uggt2
  • 0910001L17Rik
  • A930007H10Rik
  • AA589501
  • AI414429
  • AI448372
  • C820010P03Rik
  • GT
  • UGT1
  • Ugcgl1
  • Uggt
  • rUGT1
  • HUGT1
  • EMS-mutagenized bri1 suppressor 1
  • F3I17.13
  • F3I17_13
  • PRIORITY IN SWEET LIFE 2
  • PSL2
  • UDP-GLUCOSE:GLYCOPROTEIN GLUCOSYLTRANSFERASE
  • UGGT
  • UDP-glucose glycoprotein glucosyltransferase 1
  • UDP-glucose:glycoprotein glucosyltransferase
  • UGGT1
  • uggt1
  • Uggt1
  • EBS1
Reaktivität
Human, Maus, Ratte (Rattus)
35
8
7
1
1
Wirt
Kaninchen
36
Klonalität
Polyklonal
Konjugat
Dieser UGGT1 Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
35
23
18
6
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4364281
Preis und Verfügbarkeit auf Anfrage.

General

Antigen UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(35), (8), (7), (1), (1)
Wirt Kaninchen
(36)
Klonalität
Polyklonal
Konjugat Dieser UGGT1 Antikörper ist unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(35), (23), (18), (6), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-UGGT1 Antikörper

Target Details UGGT1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KVKVEHVVSVLEKKYPYVEVNSILGIDSAYDRNRKEARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELETITMHKILETTTFFQRAVYLGELPHDQDVVEYIMNQPNVVPRINSRILTAERDYLDLTASNNFFVDDYA
Isotyp IgG

Target Details UGGT1

Produktdetails anti-UGGT1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung UGGT1 (UGGT1 Antibody Abstract)
Hintergrund Gene Symbol: UGGT1
Gen-ID 56886
Pathways Activation of Innate immune Response

Anwendungsinformationen

Produktdetails anti-UGGT1 Antikörper Target Details UGGT1 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-UGGT1 Antikörper Target Details UGGT1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-UGGT1 Antikörper Target Details UGGT1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1) antibody (ABIN4364281) Western Blot: UGGT1 Antibody - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibrobla...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1) antibody (ABIN4364281) Immunohistochemistry-Paraffin: UGGT1 Antibody - Staining of human epididymis shows s...