anti-Human LSM14A Antikörper für Immunocytochemistry

Recommended LSM14A Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A) Antikörper
  • fam61a
  • lsm14a
  • wu:fj52e11
  • zgc:63681
  • zgc:66203
  • zgc:77302
  • RAP55A
  • rap55
  • FAM61A
  • 2700023B17Rik
  • AA407828
  • AU017544
  • Tral
  • RAP55
  • RAP55A-A
  • rap55a
  • xRAP55
  • xRAP55A
  • C19orf13
  • RGD1305695
  • LSM14 homolog Aa (SCD6, S. cerevisiae)
  • LSM14A, SCD6 homolog A
  • LSM14A, SCD6 homolog A (S. cerevisiae)
  • LSM14 homolog A (SCD6, S. cerevisiae)
  • lsm14aa
  • lsm14a
  • LSM14A
  • Lsm14a
  • lsm14a-a
Reaktivität
Human
44
12
12
4
4
4
3
3
3
2
1
1
Wirt
Kaninchen
41
3
Klonalität
Polyklonal
Konjugat
Dieser LSM14A Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
42
26
18
3
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4331745
Preis und Verfügbarkeit auf Anfrage.

General

Antigen LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A) Antikörper
Reaktivität Human
(44), (12), (12), (4), (4), (4), (3), (3), (3), (2), (1), (1)
Wirt Kaninchen
(41), (3)
Klonalität
Polyklonal
Konjugat Dieser LSM14A Antikörper ist unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(42), (26), (18), (3), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-LSM14A Antikörper

Target Details LSM14A Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVS
Isotyp IgG

Target Details LSM14A

Produktdetails anti-LSM14A Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung LSM14A (LSM14A Antibody Abstract)
Hintergrund Gene Symbol: LSM14A
Gen-ID 26065
Forschungsgebiet DNA/RNA, Immunology
Pathways Activation of Innate immune Response, Ribonucleoprotein Complex Subunit Organization

Anwendungsinformationen

Produktdetails anti-LSM14A Antikörper Target Details LSM14A Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-LSM14A Antikörper Target Details LSM14A Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-LSM14A Antikörper Target Details LSM14A Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A) antibody (ABIN4331745) Immunocytochemistry/Immunofluorescence: LSM14A Antibody [NBP1-88473] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A) antibody (ABIN4331745) Immunohistochemistry-Paraffin: LSM14A Antibody [NBP1-88473] - staining of human skin ...
Western Blotting (WB) image for anti-LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A) antibody (ABIN4331745) Western Blot: LSM14A Antibody [NBP1-88473] - Lane 1: Marker [kDa] 250, 130, 95, 72, 5...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A) antibody (ABIN4331745) Immunohistochemistry-Paraffin: LSM14A Antibody - Staining of human tonsil shows mode...