anti-Human Calreticulin 3 Antikörper für Immunohistochemistry

Recommended Calreticulin 3 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Calreticulin 3 (CALR3) Antikörper
  • AtCRT1b
  • T12M4.8
  • T12M4_8
  • calreticulin 1b
  • CMH19
  • CRT2
  • CT93
  • 1700031L01Rik
  • 6330586I20Rik
  • Crt2
  • cspn
  • A. thaliana calreticulin 3
  • AtCRT3
  • CALRETICULIN 3
  • EBS2
  • EMS-MUTAGENIZED BRI1 SUPPRESSOR 2
  • PRIORITY IN SWEET LIFE 1
  • PSL1
  • T27G7.13
  • T27G7_13
  • calreticulin 3
  • calreticulin 3
  • calreticulin 1b
  • calreticulin-3
  • Calr3
  • CALR3
  • CRT1b
  • CRT3
Reaktivität
Human
80
13
10
5
4
2
2
2
2
1
1
Wirt
Kaninchen
39
39
2
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
4
3
3
3
3
3
3
3
2
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
51
28
20
6
4
3
3
3
2
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4287502
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4287503 IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 1
1 ABIN443224 IHC (p) IHC WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal
1 ABIN5567597 FACS ICC IF IHC PE Rabbit AA 20-384 Anmelden zum Anzeigen Polyclonal
1 ABIN5567593 FACS ICC IF IHC APC Rabbit AA 20-384 Anmelden zum Anzeigen Polyclonal
1 ABIN5567595 FACS ICC IF IHC FITC Rabbit AA 20-384 Anmelden zum Anzeigen Polyclonal
1 ABIN2983789 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Calreticulin 3 (CALR3) Antikörper
Reaktivität Human
(80), (13), (10), (5), (4), (2), (2), (2), (2), (1), (1)
Wirt Kaninchen
(39), (39), (2)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(4), (4), (3), (3), (3), (3), (3), (3), (3), (2), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(51), (28), (20), (6), (4), (3), (3), (3), (2), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRN
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Calreticulin-2/CALR3 (CALR3 Antibody Abstract)
Hintergrund Gene Symbol: CALR3
Gen-ID 125972
UniProt Q96L12
Pathways Activation of Innate immune Response

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Calreticulin 3 (CALR3) antibody (ABIN4287502) Immunohistochemistry: CALR3 Antibody [NBP2-33390] - Immunohistochemical staining of h...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calreticulin 3 (CALR3) antibody (ABIN4287502) Immunohistochemistry-Paraffin: CALR3 Antibody [NBP2-33390] - uterus
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calreticulin 3 (CALR3) antibody (ABIN4287502) Immunohistochemistry-Paraffin: CALR3 Antibody [NBP2-33390] - liver cancer
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Calreticulin 3 (CALR3) antibody (ABIN4287502) Immunohistochemistry-Paraffin: Calreticulin-2/CALR3 Antibody - Staining of human tes...