WASF1 Antikörper

Produktnummer ABIN8115785

Der Kaninchen Polyklonal anti-WASF1 Antikörper wird verwendet zum Nachweis von WASF1 in Proben von Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Saccharomyces cerevisiae und Zebrafisch (Danio rerio). Er wurde validiert für IHC.

Kurzübersicht für WASF1 Antikörper (ABIN8115785)

Target: WASF1 (WAS Protein Family, Member 1 (WASF1))

Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Saccharomyces cerevisiae, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WASF1 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-WASF1 Antikörper

Verwendungszweck: WASF1 Antibody

Sequenz: TPYRDDGKEG LKFYTNPSYF FDLWKEKMLQ DTEDKRKEKR KQKQKNLDRP

Homologie: Cow: 100%, Dog: 100%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Yeast: 83%, Zebrafish: 92%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence TPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRP

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP63994-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu WASF1

Target: WASF1 (WAS Protein Family, Member 1 (WASF1))

Andere Bezeichnung: WASF1

Hintergrund:

Background Information: The protein encoded by this gene, a member of the Wiskott-Aldrich syndrome protein (WASP)-family, plays a critical role downstream of Rac, a Rho-family small GTPase, in regulating the actin cytoskeleton required for membrane ruffling. It has been shown to associate with an actin nucleation core Arp2/3 complex while enhancing actin polymerization in vitro. Wiskott-Aldrich syndrome is a disease of the immune system, likely due to defects in regulation of actin cytoskeleton. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

Gene Name: WAS protein family, member 1

Alternative Symbols: WAVE, SCAR1, WAVE1, NEDALVS

Protein Name: Wiskott-Aldrich syndrome protein family member 1

Molekulargewicht: 62 kDa

Gen-ID: 8936

NCBI Accession: NP_003922

UniProt: Q92558

Pathways: RTK Signalweg, Regulation of Actin Filament Polymerization