GLI3 Antikörper

Produktnummer ABIN8101492

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch GLI3 in IHC. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte, Hund, Kaninchen, Rind (Kuh), Pferd, Meerschweinchen und Zebrafisch (Danio rerio).

Kurzübersicht für GLI3 Antikörper (ABIN8101492)

Target: GLI3 (GLI Family Zinc Finger 3 (GLI3))

Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Rind (Kuh), Pferd, Meerschweinchen, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLI3 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Produktdetails anti-GLI3 Antikörper

Verwendungszweck: GLI3 Antibody

Sequenz: KPDEDLPSPG ARGQQEQPEG TTLVKEEGDK DESKQEPEVI YETNCHWEGC

Homologie: Cow: 100%, Dog: 93%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Zebrafish: 79%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence KPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGC

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP32317-100UG

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: prevent freeze-thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Details zu GLI3

Target: GLI3 (GLI Family Zinc Finger 3 (GLI3))

Andere Bezeichnung: GLI3

Hintergrund:

Background Information: This gene encodes a protein which belongs to the C2H2-type zinc finger proteins subclass of the Gli family. They are characterized as DNA-binding transcription factors and are mediators of Sonic hedgehog (Shh) signaling. The protein encoded by this gene localizes in the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. Mutations in this gene have been associated with several diseases, including Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, and postaxial polydactyly types A1 and B.

Gene Name: GLI family zinc finger 3

Alternative Symbols: PHS, ACLS, GCPS, PAPA, PAPB, PAP-A, PAPA1, PPDIV, GLI3FL, GLI3-190

Protein Name: Transcriptional activator GLI3

Molekulargewicht: 170 kDa

Gen-ID: 2737

NCBI Accession: NP_000159

UniProt: P10071

Pathways: Hedgehog Signalweg