SUMO1 Antikörper

Produktnummer ABIN7882287

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SUMO1 in IF, FACS und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human, Ratte und Maus.

Kurzübersicht für SUMO1 Antikörper (ABIN7882287)

Target: SUMO1 (Small Ubiquitin Related Modifier Protein 1 (SUMO1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SUMO1 Antikörper ist unkonjugiert

Applikation: Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-SUMO1 Antikörper

Verwendungszweck: SUMO1 Antibody

Sequenz: HLKKLKESYC QRQGVPMNSL RFLFEGQRIA DNHTPKEL

Aufreinigung: Affinity purified

Immunogen: Amino acids HLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL from the human protein were used as the immunogen for the SUMO1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the SUMO1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the SUMO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu SUMO1

Target: SUMO1 (Small Ubiquitin Related Modifier Protein 1 (SUMO1))

Andere Bezeichnung: SUMO1

Hintergrund: Small ubiquitin-related modifier 1(SUMO1), also called SMT3C or PIC1 is a protein that in humans is encoded by the SUMO1 gene. This gene is mapped to 2q33.1. This gene encodes a protein that is a member of the SUMO(small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene.

UniProt: P63165

Pathways: M Phase, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus, Ubiquitin Proteasome Pathway