GRIA2 Antikörper (AA 834-883)

Produktnummer ABIN7595946

Der Maus Monoklonal Anti-GRIA2-Antikörper wurde für WB, IHC, IP, ICC und IEM validiert. Er ist geeignet, GRIA2 in Proben von Ratte zu detektieren.

Kurzübersicht für GRIA2 Antikörper (AA 834-883) (ABIN7595946)

Target: GRIA2 (Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2))

Reaktivität: Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser GRIA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC), Immunoelectron Microscopy (IEM)

Klon: L21-32

Produktdetails anti-GRIA2 Antikörper

Bindungsspezifität: AA 834-883

Verwendungszweck: Anti-GluA2/GluR2 Glutamate Receptor Antibody

Spezifität: No off-targets reported for GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)

Kreuzreaktivität: Human, Maus, Ratte

Produktmerkmale:

Description: Our Anti-GluA2/GluR2 glutamate receptor mouse monoclonal primary antibody is produced in-house from hybridoma clone L21/32. It is KO validated, detects human, mouse, and rat GluA2/GluR2 glutamate receptor, and is purified by Protein A chromatography. It is great for use in EM, IHC, ICC, IP, WB.

Manufacturer Comment: We produce our GluA2/GluR2 glutamate receptor mouse monoclonal primary antibody from hybridoma clone L21/32. It is great in EM, IHC, ICC, IP, WB and is purified by Protein A chromatography.

Aufreinigung: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography.

Reinheit: > 90 % specific antibody

Immunogen: Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise:

Dilution Range: IHC: 1:250

Dilution Range: ICC: 1:500

Dilution Range: WB: 1:500

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 1 mg/mL

Buffer: 10 mM Tris, 50 mM Sodium Chloride, 0.065 % Sodium Azide pH 7.4

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.

Haltbarkeit: 24 months

Details zu GRIA2

Target: GRIA2 (Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2))

Andere Bezeichnung: GluR2 glutamate receptor

Hintergrund:

Synonyms: Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Target Description: Glutelin type-A 2 (GluA2) , also called GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2 or glutamate ionotropic receptor AMPA type subunit 2, is a member of the Glutamate receptor family of the mammalian brain. This neurotransmiter receptor subunit, which is activated during normal central nervous system fuction, is encoded by the GRIA2 (or GLUR2) gene. GluA2 constitutes a key subunit that regulates AMPA receptors. AMPA receptors lacking of Glua2 have been shown to be present in diseased brains, whose basic fuctions have been altered.

Gene Name Alternatives: Gria2 Glur2

Molekulargewicht: 90 kDa

Pathways: PI3K-Akt Signalweg