NONO Antikörper

Produktnummer ABIN6654182

Dieses Anti-NONO-Antikörper ist ein Maus Monoklonal-Antikörper zur Detektion von NONO in WB, ICC und FACS. Geeignet für Human.

Kurzübersicht für NONO Antikörper (ABIN6654182)

Target: NONO (Non-POU Domain Containing, Octamer-Binding (NONO))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser NONO Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunocytochemistry (ICC), Flow Cytometry (FACS)

Klon: 11E2-

Produktdetails anti-NONO Antikörper

Aufreinigung: Protein G affinity

Immunogen: Amino acids MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ were used as the immunogen for the NONO antibody.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the NONO antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,ICC (FFPE): 1-2 μg/mL,FACS: 1-3 μg/10^6 cells

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the NONO antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu NONO

Target: NONO (Non-POU Domain Containing, Octamer-Binding (NONO))

Andere Bezeichnung: NONO / p54nrb

Hintergrund: Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.

UniProt: Q15233