APOB Antikörper (Middle Region)

Produktnummer ABIN636056

Der Kaninchen Polyklonal anti-APOB Antikörper wird verwendet zum Nachweis von APOB in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für APOB Antikörper (Middle Region) (ABIN636056)

Target: APOB (Apolipoprotein B (APOB))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APOB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-APOB Antikörper

Bindungsspezifität: Middle Region

Spezifität: ApoB antibody was raised against the middle region of APOB

Aufreinigung: Affinity purified

Immunogen: ApoB antibody was raised using the middle region of APOB corresponding to a region with amino acids SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ApoB Blocking Peptide, (ABIN5612112), is also available for use as a blocking control in assays to test for specificity of this ApoB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APOB

Target: APOB (Apolipoprotein B (APOB))

Andere Bezeichnung: ApoB

Hintergrund: This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver.

Molekulargewicht: 241 kDa (MW of target protein)

Pathways: Lipid Metabolism