Oncostatin M Receptor Antikörper (N-Term)

Produktnummer ABIN635957

Der Kaninchen Polyklonal Anti-Oncostatin M Receptor-Antikörper wurde für WB validiert. Er ist geeignet, Oncostatin M Receptor in Proben von Human zu detektieren.

Kurzübersicht für Oncostatin M Receptor Antikörper (N-Term) (ABIN635957)

Target: Oncostatin M Receptor (OSMR)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Oncostatin M Receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Oncostatin M Receptor Antikörper

Bindungsspezifität: N-Term

Spezifität: OSMR antibody was raised against the N terminal of OSMR

Aufreinigung: Affinity purified

Immunogen: OSMR antibody was raised using the N terminal of OSMR corresponding to a region with amino acids YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OSMR Blocking Peptide, (ABIN936190), is also available for use as a blocking control in assays to test for specificity of this OSMR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSMR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Oncostatin M Receptor

Target: Oncostatin M Receptor (OSMR)

Andere Bezeichnung: OSMR

Hintergrund: Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells.

Molekulargewicht: 110 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, Growth Factor Binding