Tyrosinase-Related Protein 1 Antikörper (Middle Region)
Kurzübersicht für Tyrosinase-Related Protein 1 Antikörper (Middle Region) (ABIN635947)
Target
Alle Tyrosinase-Related Protein 1 (TYRP1) Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- Middle Region
-
Spezifität
- TYRP1 antibody was raised against the middle region of TYRP1
-
Aufreinigung
- Affinity purified
-
Immunogen
- TYRP1 antibody was raised using the middle region of TYRP1 corresponding to a region with amino acids NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
TYRP1 Blocking Peptide, (ABIN5616853), is also available for use as a blocking control in assays to test for specificity of this TYRP1 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYRP1 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- Tyrosinase-Related Protein 1 (TYRP1)
-
Andere Bezeichnung
- TYRP1
-
Hintergrund
- TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized.
-
Molekulargewicht
- 61 kDa (MW of target protein)
Target
-