UBE2D2 Antikörper

Produktnummer ABIN635549

Produktdetails anti-UBE2D2 Antikörper

Target: UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2D2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: UBE2 D2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSIC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2D2 Blocking Peptide, catalog no. 33R-9123, is also available for use as a blocking control in assays to test for specificity of this UBE2D2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2D2

Target: UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))

Andere Bezeichnung: UBE2D2 (UBE2D2 Produkte)

Synonyme: E2(17)KB2 antikoerper, PUBC1 antikoerper, UBC4 antikoerper, UBC4/5 antikoerper, UBCH5B antikoerper, 1500034D03Rik antikoerper, Ubc2e antikoerper, Ube2d2 antikoerper, ubc4 antikoerper, ube2d2 antikoerper, zgc:55886 antikoerper, E217kB antikoerper, ubiquitin conjugating enzyme E2 D2 antikoerper, ubiquitin-conjugating enzyme E2D 2A antikoerper, ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) antikoerper, ubiquitin-conjugating enzyme E2D 2 antikoerper, ubiquitin conjugating enzyme E2 D3 antikoerper, UBE2D2 antikoerper, Ube2d2a antikoerper, ube2d2 antikoerper, Ube2d2 antikoerper, UBE2D3 antikoerper

Hintergrund: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades