MPG Antikörper (Middle Region)

Produktnummer ABIN635545

Produktdetails anti-MPG Antikörper

Target: MPG (N-Methylpurine-DNA Glycosylase (MPG))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MPG antibody was raised against the middle region of MPG

Aufreinigung: Affinity purified

Immunogen: MPG antibody was raised using the middle region of MPG corresponding to a region with amino acids QRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MPG Blocking Peptide, catalog no. 33R-7705, is also available for use as a blocking control in assays to test for specificity of this MPG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MPG

Target: MPG (N-Methylpurine-DNA Glycosylase (MPG))

Andere Bezeichnung: MPG (MPG Produkte)

Synonyme: AAG antikoerper, ADPG antikoerper, APNG antikoerper, CRA36.1 antikoerper, MDG antikoerper, Mid1 antikoerper, PIG11 antikoerper, PIG16 antikoerper, anpg antikoerper, 9830006D05 antikoerper, AI326268 antikoerper, Aag antikoerper, zgc:162984 antikoerper, si:xx-187g17.9 antikoerper, MPG antikoerper, MPGR antikoerper, N-methylpurine DNA glycosylase antikoerper, N-methylpurine-DNA glycosylase antikoerper, si:xx-by187g17.9 antikoerper, MPG antikoerper, Mpg antikoerper, mpg antikoerper, si:xx-by187g17.9 antikoerper, CpB0526 antikoerper, gll2491 antikoerper

Hintergrund: MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.

Molekulargewicht: 31 kDa (MW of target protein)

Pathways: DNA Reparatur