MPG Antikörper (Middle Region)
-
- Target Alle MPG Antikörper anzeigen
- MPG (N-Methylpurine-DNA Glycosylase (MPG))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MPG Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MPG antibody was raised against the middle region of MPG
- Aufreinigung
- Affinity purified
- Immunogen
- MPG antibody was raised using the middle region of MPG corresponding to a region with amino acids QRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS
- Top Product
- Discover our top product MPG Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MPG Blocking Peptide, catalog no. 33R-7705, is also available for use as a blocking control in assays to test for specificity of this MPG antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPG (N-Methylpurine-DNA Glycosylase (MPG))
- Andere Bezeichnung
- MPG (MPG Produkte)
- Synonyme
- AAG antikoerper, ADPG antikoerper, APNG antikoerper, CRA36.1 antikoerper, MDG antikoerper, Mid1 antikoerper, PIG11 antikoerper, PIG16 antikoerper, anpg antikoerper, 9830006D05 antikoerper, AI326268 antikoerper, Aag antikoerper, zgc:162984 antikoerper, si:xx-187g17.9 antikoerper, MPG antikoerper, MPGR antikoerper, N-methylpurine DNA glycosylase antikoerper, N-methylpurine-DNA glycosylase antikoerper, si:xx-by187g17.9 antikoerper, MPG antikoerper, Mpg antikoerper, mpg antikoerper, si:xx-by187g17.9 antikoerper, CpB0526 antikoerper, gll2491 antikoerper
- Hintergrund
- MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.
- Molekulargewicht
- 31 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-