N-Methylpurine-DNA Glycosylase (MPG) (C-Term) Antikörper

Details zu Produkt Nr. ABIN635211
Antigen
Epitop
C-Term
13
13
3
3
2
2
2
2
2
1
1
Reaktivität
Human
88
39
39
4
2
2
2
2
1
1
Wirt
Kaninchen
70
15
7
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
75
35
25
22
13
12
6
4
1
1
1
Optionen
Immunogen MPG antibody was raised using the C terminal of MPG corresponding to a region with amino acids LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA
Spezifität MPG antibody was raised against the C terminal of MPG
Reinigung Affinity purified
Antigen
Andere Bezeichnung MPG (MPG Antibody Abstract)
Hintergrund MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.
Molekulargewicht 32 kDa (MW of target protein)
Pathways DNA Reparatur
Applikations-hinweise WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

MPG Blocking Peptide, catalog no. 33R-4919, is also available for use as a blocking control in assays to test for specificity of this MPG antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPG antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-N-Methylpurine-DNA Glycosylase (MPG) (C-Term) antibody (ABIN635211) MPG antibody used at 0.5 ug/ml to detect target protein.