WNT5A Antikörper (Middle Region)
-
- Target Alle WNT5A Antikörper anzeigen
- WNT5A (Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WNT5A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WNT5 A antibody was raised against the middle region of WNT5
- Aufreinigung
- Affinity purified
- Immunogen
- WNT5 A antibody was raised using the middle region of WNT5 corresponding to a region with amino acids GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT
- Top Product
- Discover our top product WNT5A Primärantikörper
-
anti-Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A) (AA 301-381) antibody
WNT5A Reaktivität: Human, Maus, Ratte, Hund WB, ELISA, FACS, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A) (AA 185-213) antibodyWNT5A Reaktivität: Human, Maus, Ratte WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB22340 unconjugated
anti-Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A) (AA 62-380) antibodyWNT5A Reaktivität: Human WB, IHC, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A) antibodyWNT5A Reaktivität: Human IHC, ELISA, ICC Wirt: Maus Monoclonal 6F2 unconjugated
anti-Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A) (AA 180-229) antibodyWNT5A Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Kaninchen, Fledermaus, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A) (Middle Region) antibodyWNT5A Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Kaninchen, Pferd, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A) (AA 185-213) antibodyWNT5A Reaktivität: Human WB, IHC, ELISA, FACS Wirt: Kaninchen Polyclonal unconjugated
anti-Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A) (AA 62-380) antibodyWNT5A Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A) (AA 62-380) antibodyWNT5A Reaktivität: Maus WB, IHC, IP, ICC Wirt: Maus Monoclonal C3 unconjugated
anti-Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A) (AA 201-300) antibodyWNT5A Reaktivität: Human ELISA, IHC (p) Wirt: Maus Monoclonal 3A4 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WNT5A Blocking Peptide, catalog no. 33R-3274, is also available for use as a blocking control in assays to test for specificity of this WNT5A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WNT5A (Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A))
- Andere Bezeichnung
- WNT5A (WNT5A Produkte)
- Hintergrund
- The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.
- Molekulargewicht
- 42 kDa (MW of target protein)
- Pathways
- WNT Signalweg, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Regulation of Cell Size, Tube Formation
-
