INSIG2 Antikörper (N-Term)

Produktnummer ABIN635502

Dieses Anti-INSIG2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von INSIG2 in WB. Geeignet für Human.

Kurzübersicht für INSIG2 Antikörper (N-Term) (ABIN635502)

Target: INSIG2 (Insulin Induced Gene 2 (INSIG2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser INSIG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-INSIG2 Antikörper

Bindungsspezifität: N-Term

Spezifität: INSIG2 antibody was raised against the N terminal of INSIG2

Aufreinigung: Affinity purified

Immunogen: INSIG2 antibody was raised using the N terminal of INSIG2 corresponding to a region with amino acids MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

INSIG2 Blocking Peptide, (ABIN5614202), is also available for use as a blocking control in assays to test for specificity of this INSIG2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu INSIG2

Target: INSIG2 (Insulin Induced Gene 2 (INSIG2))

Andere Bezeichnung: INSIG2

Hintergrund: INSIG2 is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling