STEAP4 Antikörper (C-Term)

Produktnummer ABIN635483

Der Kaninchen Polyklonal Anti-STEAP4-Antikörper wurde für WB validiert. Er ist geeignet, STEAP4 in Proben von Human zu detektieren.

Kurzübersicht für STEAP4 Antikörper (C-Term) (ABIN635483)

Target: STEAP4 (STEAP Family Member 4 (STEAP4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STEAP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-STEAP4 Antikörper

Bindungsspezifität: C-Term

Spezifität: STEAP4 antibody was raised against the C terminal of STEAP4

Aufreinigung: Affinity purified

Immunogen: STEAP4 antibody was raised using the C terminal of STEAP4 corresponding to a region with amino acids AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STEAP4 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this STEAP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STEAP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STEAP4

Target: STEAP4 (STEAP Family Member 4 (STEAP4))

Andere Bezeichnung: STEAP4

Hintergrund: Metalloreductase has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). It uses NAD(+) as acceptor.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis