ELAPOR1 Antikörper (N-Term)

Produktnummer ABIN635280

Dieses Anti-ELAPOR1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ELAPOR1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ELAPOR1 Antikörper (N-Term) (ABIN635280)

Target: ELAPOR1 (Endosome/Lysosome-associated Apoptosis and Autophagy Regulator 1 (ELAPOR1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ELAPOR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ELAPOR1 Antikörper

Bindungsspezifität: N-Term

Spezifität: KIAA1324 antibody was raised against the N terminal of KIAA1324

Aufreinigung: Affinity purified

Immunogen: KIAA1324 antibody was raised using the N terminal of KIAA1324 corresponding to a region with amino acids PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA1324 Blocking Peptide, (ABIN5614337), is also available for use as a blocking control in assays to test for specificity of this KIAA1324 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1324 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ELAPOR1

Target: ELAPOR1 (Endosome/Lysosome-associated Apoptosis and Autophagy Regulator 1 (ELAPOR1))

Andere Bezeichnung: KIAA1324

Hintergrund: KIAA1324 belongs to the UPF0577 family. It may play a role as a marker of hyperestrogenic state and estrogen-related type I endometrial carcinoma.

Molekulargewicht: 111 kDa (MW of target protein)