ORCTL-2/SLC22A18 Antikörper (N-Term)

Produktnummer ABIN635226

Produktdetails anti-ORCTL-2/SLC22A18 Antikörper

Target: ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ORCTL-2/SLC22A18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC22 A18 antibody was raised against the N terminal of SLC22 18

Aufreinigung: Affinity purified

Immunogen: SLC22 A18 antibody was raised using the N terminal of SLC22 18 corresponding to a region with amino acids AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC22A18 Blocking Peptide, catalog no. 33R-1050, is also available for use as a blocking control in assays to test for specificity of this SLC22A18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ORCTL-2/SLC22A18

Target: ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))

Andere Bezeichnung: SLC22A18 (SLC22A18 Produkte)

Hintergrund: This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as the transport of chloroquine- and quinidine-related compounds in the kidney.

Molekulargewicht: 45 kDa (MW of target protein)