DLL4 Antikörper
-
- Target Alle DLL4 Antikörper anzeigen
- DLL4 (delta-Like 4 (DLL4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DLL4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DLL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF
- Top Product
- Discover our top product DLL4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DLL4 Blocking Peptide, catalog no. 33R-7573, is also available for use as a blocking control in assays to test for specificity of this DLL4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLL4 (delta-Like 4 (DLL4))
- Andere Bezeichnung
- DLL4 (DLL4 Produkte)
- Hintergrund
- Notch ligands family members are characterized by a DSL domain, EGF repeats, and a transmembrane domain. DLL4 plays a role in the Notch signaling pathway. IT activates Notch-1 and Notch-4.
- Molekulargewicht
- 72 kDa (MW of target protein)
- Pathways
- Notch Signalweg
-