HLA Class I alpha F (HLAF) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635021
Antigen
Epitop
N-Term
8
8
7
3
1
Reaktivität
Human
23
2
2
2
1
1
Wirt
Kaninchen
23
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
Applikation
Western Blotting (WB)
23
9
7
5
Optionen
Immunogen HLA-F antibody was raised using the N terminal of HLA-F corresponding to a region with amino acids EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT
Spezifität HLA-F antibody was raised against the N terminal of HLA-F
Reinigung Affinity purified
Antigen
Andere Bezeichnung HLA-F (HLAF Antibody Abstract)
Hintergrund HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation.
Molekulargewicht 48 kDa (MW of target protein)
Pathways Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Human Leukocyte Antigen (HLA) in Adaptive Immune Response
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

HLA-F Blocking Peptide, catalog no. 33R-2261, is also available for use as a blocking control in assays to test for specificity of this HLA-F antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-F antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-HLA Class I alpha F (HLAF) (N-Term) antibody (ABIN635021) HLA-F antibody used at 1 ug/ml to detect target protein.