HLA-F Antikörper (N-Term)
-
- Target Alle HLA-F (HLAF) Antikörper anzeigen
- HLA-F (HLAF) (HLA Class I alpha F (HLAF))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HLA-F Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HLA-F antibody was raised against the N terminal of HLA-F
- Aufreinigung
- Affinity purified
- Immunogen
- HLA-F antibody was raised using the N terminal of HLA-F corresponding to a region with amino acids EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT
- Top Product
- Discover our top product HLAF Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HLA-F Blocking Peptide, catalog no. 33R-2261, is also available for use as a blocking control in assays to test for specificity of this HLA-F antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-F antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HLA-F (HLAF) (HLA Class I alpha F (HLAF))
- Andere Bezeichnung
- HLA-F (HLAF Produkte)
- Synonyme
- HLAF antikoerper, CDA12 antikoerper, HLA-5.4 antikoerper, HLA-CDA12 antikoerper, major histocompatibility complex, class I, F antikoerper, HLA-F antikoerper
- Hintergrund
- HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Human Leukocyte Antigen (HLA) in Adaptive Immune Response
-