HLA-F Antikörper (N-Term)

Produktnummer ABIN635005

Produktdetails anti-HLA-F Antikörper

Target: HLA-F (HLAF) (HLA Class I alpha F (HLAF))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HLA-F Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HLA-F antibody was raised against the N terminal of HLA-F

Aufreinigung: Affinity purified

Immunogen: HLA-F antibody was raised using the N terminal of HLA-F corresponding to a region with amino acids PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HLA-F Blocking Peptide, catalog no. 33R-7437, is also available for use as a blocking control in assays to test for specificity of this HLA-F antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-F antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HLA-F

Target: HLA-F (HLAF) (HLA Class I alpha F (HLAF))

Andere Bezeichnung: HLA-F (HLAF Produkte)

Synonyme: HLAF antikoerper, CDA12 antikoerper, HLA-5.4 antikoerper, HLA-CDA12 antikoerper, major histocompatibility complex, class I, F antikoerper, HLA-F antikoerper

Hintergrund: HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process