DLL4 Antikörper

Produktnummer ABIN634987

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch DLL4 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für DLL4 Antikörper (ABIN634987)

Target: DLL4 (delta-Like 4 (DLL4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLL4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DLL4 Antikörper

Aufreinigung: Affinity purified

Immunogen: DLL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLL4 Blocking Peptide, (ABIN5613219), is also available for use as a blocking control in assays to test for specificity of this DLL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLL4

Target: DLL4 (delta-Like 4 (DLL4))

Andere Bezeichnung: DLL4

Hintergrund: Notch ligands family members are characterized by a DSL domain, EGF repeats, and a transmembrane domain. DLL4 plays a role in the Notch signaling pathway. IT activates Notch-1 and Notch-4.

Molekulargewicht: 72 kDa (MW of target protein)

Pathways: Notch Signalweg