-
- Target Alle DLL4 Antikörper anzeigen
- DLL4 (delta-Like 4 (DLL4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DLL4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DLL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
- Top Product
- Discover our top product DLL4 Primärantikörper
-
anti-delta-Like 4 (DLL4) antibody
DLL4 Reaktivität: Human ELISA, FACS Wirt: Maus Monoclonal 4A11G2 unconjugated
anti-delta-Like 4 (DLL4) (AA 313-439) antibodyDLL4 Reaktivität: Human ELISA, IHC Wirt: Maus Monoclonal 4A11F8 unconjugated
anti-delta-Like 4 (DLL4) (AA 215-331) antibodyDLL4 Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-delta-Like 4 (DLL4) antibodyDLL4 Reaktivität: Human WB, ELISA, IHC, IHC (p) Wirt: Maus Monoclonal 4A11F8 unconjugated
anti-delta-Like 4 (DLL4) (AA 625-652), (C-Term) antibodyDLL4 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB23696 unconjugated
anti-delta-Like 4 (DLL4) antibodyDLL4 Reaktivität: Maus, Ratte IHC Wirt: Kaninchen Polyclonal unconjugated
anti-delta-Like 4 (DLL4) (Internal Region) antibodyDLL4 Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-delta-Like 4 (DLL4) antibodyDLL4 Reaktivität: Human WB, EIA Wirt: Maus Monoclonal 4A11F8-4A11G2 unconjugated
anti-delta-Like 4 (DLL4) antibodyDLL4 Reaktivität: Human FACS, Func Wirt: Maus Monoclonal MHD4-46 unconjugated
anti-delta-Like 4 (DLL4) antibodyDLL4 Reaktivität: Human FACS Wirt: Maus Monoclonal MHD4-46 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DLL4 Blocking Peptide, catalog no. 33R-7121, is also available for use as a blocking control in assays to test for specificity of this DLL4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLL4 (delta-Like 4 (DLL4))
- Andere Bezeichnung
- DLL4 (DLL4 Produkte)
- Hintergrund
- Notch ligands family members are characterized by a DSL domain, EGF repeats, and a transmembrane domain. DLL4 plays a role in the Notch signaling pathway. IT activates Notch-1 and Notch-4.
- Molekulargewicht
- 72 kDa (MW of target protein)
- Pathways
- Notch Signalweg
-
Sie sind hier:
