LRRC8A Antikörper (N-Term)

Produktnummer ABIN634965

Der Kaninchen Polyklonal anti-LRRC8A Antikörper (ABIN634965) detektiert spezifisch LRRC8A in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für LRRC8A Antikörper (N-Term) (ABIN634965)

Target: LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A (LRRC8A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC8A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LRRC8A Antikörper

Bindungsspezifität: N-Term

Spezifität: LRRC8 A antibody was raised against the N terminal of LRRC8

Aufreinigung: Affinity purified

Immunogen: LRRC8 A antibody was raised using the N terminal of LRRC8 corresponding to a region with amino acids IPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC8A Blocking Peptide, (ABIN939491), is also available for use as a blocking control in assays to test for specificity of this LRRC8A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC8A

Target: LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A (LRRC8A))

Andere Bezeichnung: LRRC8A

Hintergrund: LRRC8A is a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. LRRC8A is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation.

Molekulargewicht: 94 kDa (MW of target protein)