LRRC8A Antikörper (N-Term)
-
- Target Alle LRRC8A Antikörper anzeigen
- LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A (LRRC8A))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRRC8A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LRRC8 A antibody was raised against the N terminal of LRRC8
- Aufreinigung
- Affinity purified
- Immunogen
- LRRC8 A antibody was raised using the N terminal of LRRC8 corresponding to a region with amino acids IPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDK
- Top Product
- Discover our top product LRRC8A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRRC8A Blocking Peptide, catalog no. 33R-4105, is also available for use as a blocking control in assays to test for specificity of this LRRC8A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A (LRRC8A))
- Andere Bezeichnung
- LRRC8A (LRRC8A Produkte)
- Synonyme
- AGM5 antikoerper, LRRC8 antikoerper, Lrrc8 antikoerper, mKIAA1437 antikoerper, wu:fb18g12 antikoerper, wu:fi21b10 antikoerper, LLRC8A antikoerper, leucine rich repeat containing 8 VRAC subunit A antikoerper, leucine rich repeat containing 8A antikoerper, leucine rich repeat containing 8 VRAC subunit Aa antikoerper, leucine-rich repeat containing 8 family member A S homeolog antikoerper, leucine rich repeat containing 8 family member A antikoerper, LRRC8A antikoerper, Lrrc8a antikoerper, lrrc8aa antikoerper, lrrc8a.S antikoerper
- Hintergrund
- LRRC8A is a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. LRRC8A is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation.
- Molekulargewicht
- 94 kDa (MW of target protein)
-