Podocalyxin-Like (PODXL) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN634824
Antigen
Epitop
Middle Region
73
22
17
8
5
4
4
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Reaktivität
Human
220
92
71
22
1
1
Wirt
Kaninchen
139
94
7
3
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
15
12
7
6
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
1
1
1
1
Applikation
Western Blotting (WB)
146
107
86
67
66
48
39
36
13
10
6
5
3
3
2
1
Optionen
Immunogen PODXL antibody was raised using the middle region of PODXL corresponding to a region with amino acids PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ
Spezifität PODXL antibody was raised against the middle region of PODXL
Reinigung Affinity purified
Antigen
Andere Bezeichnung PODXL (PODXL Antibody Abstract)
Hintergrund PODXL is a member of the sialomucin protein family. PODXL was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin.
Molekulargewicht 56 kDa (MW of target protein)
Pathways Tube Formation
Applikations-hinweise WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PODXL Blocking Peptide, catalog no. 33R-6983, is also available for use as a blocking control in assays to test for specificity of this PODXL antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PODXL antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Podocalyxin-Like (PODXL) (Middle Region) antibody (ABIN634824) PODXL antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Mag...
Image no. 2 for anti-Podocalyxin-Like (PODXL) (Middle Region) antibody (ABIN634824) PODXL antibody used at 0.5 ug/ml to detect target protein.