Hepcidin Antikörper (N-Term)

Produktnummer ABIN634809

Produktdetails anti-Hepcidin Antikörper

Target: Hepcidin (HAMP) (Hepcidin Antimicrobial Peptide (HAMP))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Hepcidin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HAMP antibody was raised against the N terminal of HAMP

Aufreinigung: Affinity purified

Immunogen: HAMP antibody was raised using the N terminal of HAMP corresponding to a region with amino acids MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAMP Blocking Peptide, catalog no. 33R-5697, is also available for use as a blocking control in assays to test for specificity of this HAMP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAMP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-Hepcidin Antikörper (ABIN634809)

Blanchette-Farra, Kita, Konstorum, Tesfay, Lemler, Hegde, Claffey, Torti, Torti: "Contribution of three-dimensional architecture and tumor-associated fibroblasts to hepcidin regulation in breast cancer." in: Oncogene, Vol. 37, Issue 29, pp. 4013-4032, (2019) (PubMed).

Details zu Hepcidin

Target: Hepcidin (HAMP) (Hepcidin Antimicrobial Peptide (HAMP))

Andere Bezeichnung: HAMP (HAMP Produkte)

Synonyme: HEPC antikoerper, HFE2B antikoerper, LEAP1 antikoerper, PLTR antikoerper, Hepcidin antikoerper, Hamp1 antikoerper, Hepc antikoerper, Hepc1 antikoerper, HAMP antikoerper, hepcidin antikoerper, hamp1 antikoerper, hep1 antikoerper, hepcidin antimicrobial peptide antikoerper, hepcidin-like antikoerper, hepcidin-1 antikoerper, Ham percentage antikoerper, HAMP antikoerper, Hamp antikoerper, hamp antikoerper, LOC100135935 antikoerper, LOC106584587 antikoerper

Hintergrund: The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption.

Molekulargewicht: 9 kDa (MW of target protein)

Pathways: Hormone Activity, Transition Metal Ion Homeostasis