Hepcidin Antikörper (Hepcidin Antimicrobial Peptide) (N-Term)

Details for Product anti-HAMP Antibody No. ABIN634809
Antigen
Epitop
N-Term
17
10
9
8
7
7
6
5
5
2
2
2
2
1
1
1
1
Reaktivität
Human
86
32
11
4
3
2
1
Wirt
Kaninchen
91
15
8
Klonalität
Polyklonal
Konjugat
Dieser Hepcidin Antikörper ist unkonjugiert
13
9
3
3
3
3
2
2
2
2
2
2
Applikation
Western Blotting (WB)
90
61
35
12
9
8
6
5
4
3
2
2
1
1
1
Optionen
Immunogen HAMP antibody was raised using the N terminal of HAMP corresponding to a region with amino acids MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM
Spezifität HAMP antibody was raised against the N terminal of HAMP
Reinigung Affinity purified
Antigen
Andere Bezeichnung HAMP (HAMP Antibody Abstract)
Hintergrund The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption.
Molekulargewicht 9 kDa (MW of target protein)
Pathways Hormone Activity, Transition Metal Ion Homeostasis
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

HAMP Blocking Peptide, catalog no. 33R-5697, is also available for use as a blocking control in assays to test for specificity of this HAMP antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAMP antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Hepcidin Antimicrobial Peptide (HAMP) (N-Term) antibody (ABIN634809) HAMP antibody used at 1 ug/ml to detect target protein.