IL-9 Antikörper (Middle Region)
-
- Target Alle IL-9 (IL9) Antikörper anzeigen
- IL-9 (IL9) (Interleukin 9 (IL9))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IL-9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IL9 antibody was raised against the middle region of IL9
- Aufreinigung
- Affinity purified
- Immunogen
- IL9 antibody was raised using the middle region of IL9 corresponding to a region with amino acids SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT
- Top Product
- Discover our top product IL9 Primärantikörper
-
anti-Interleukin 9 (IL9) (AA 21-120) antibody
IL9 Reaktivität: Maus WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 9 (IL9) (AA 19-144) antibodyIL9 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 9 (IL9) antibodyIL9 Reaktivität: Human, Ratte IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 9 (IL9) (AA 19-144) antibodyIL9 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 9 (IL9) (AA 19-144) antibodyIL9 Reaktivität: Human WB, IHC, IP, ICC Wirt: Maus Monoclonal C2 unconjugated
anti-Interleukin 9 (IL9) (AA 19-144) antibodyIL9 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 9 (IL9) (Internal Region) antibodyIL9 Reaktivität: Human, Ratte WB, ELISA, IHC, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Interleukin 9 (IL9) antibody (Biotin)IL9 Reaktivität: Human WB, ELISA, Neut Wirt: Kaninchen Polyclonal Biotin
anti-Interleukin 9 (IL9) antibody (Biotin)IL9 Reaktivität: Maus WB, ELISA, Neut Wirt: Kaninchen Polyclonal Biotin
anti-Interleukin 9 (IL9) antibody (PE)IL9 Reaktivität: Maus FACS Wirt: Ratte Monoclonal RM9A4 PE
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IL9 Blocking Peptide, catalog no. 33R-8718, is also available for use as a blocking control in assays to test for specificity of this IL9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL-9 (IL9) (Interleukin 9 (IL9))
- Andere Bezeichnung
- IL9 (IL9 Produkte)
- Hintergrund
- IL9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding IL9 has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that IL9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.
- Molekulargewicht
- 14 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg
-
