IL9 Antikörper (Interleukin 9) (Middle Region)

Details for Product anti-IL9 Antibody No. ABIN634807
Antigen
Epitop
Middle Region
15
13
7
3
3
2
2
1
1
1
1
1
1
Reaktivität
Human
82
52
32
1
1
1
1
1
Wirt
Kaninchen
113
10
4
1
Klonalität
Polyklonal
Konjugat
Dieser IL9 Antikörper ist unkonjugiert
16
5
4
4
3
2
2
2
2
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
92
67
23
22
13
13
8
8
7
6
4
2
2
1
1
Optionen
Immunogen IL9 antibody was raised using the middle region of IL9 corresponding to a region with amino acids SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT
Spezifität IL9 antibody was raised against the middle region of IL9
Reinigung Affinity purified
Antigen
Andere Bezeichnung IL9 (IL9 Antibody Abstract)
Hintergrund IL9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding IL9 has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that IL9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.
Molekulargewicht 14 kDa (MW of target protein)
Pathways JAK-STAT Signalweg
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

IL9 Blocking Peptide, catalog no. 33R-8718, is also available for use as a blocking control in assays to test for specificity of this IL9 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL9 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Interleukin 9 (IL9) (Middle Region) antibody (ABIN634807) IL9 antibody used at 1 ug/ml to detect target protein.