IL-9 Antikörper (Middle Region)

Produktnummer ABIN634807

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch IL-9 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für IL-9 Antikörper (Middle Region) (ABIN634807)

Target: IL-9 (IL9) (Interleukin 9 (IL9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL-9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IL-9 Antikörper

Bindungsspezifität: Middle Region

Spezifität: IL9 antibody was raised against the middle region of IL9

Aufreinigung: Affinity purified

Immunogen: IL9 antibody was raised using the middle region of IL9 corresponding to a region with amino acids SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL9 Blocking Peptide, (ABIN5614179), is also available for use as a blocking control in assays to test for specificity of this IL9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL-9

Target: IL-9 (IL9) (Interleukin 9 (IL9))

Andere Bezeichnung: IL9

Hintergrund: IL9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding IL9 has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that IL9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.

Molekulargewicht: 14 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg