Cadherin-16 Antikörper (N-Term)
-
- Target Alle Cadherin-16 (CDH16) Antikörper anzeigen
- Cadherin-16 (CDH16)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Cadherin-16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CDH16 antibody was raised against the N terminal of CDH16
- Aufreinigung
- Affinity purified
- Immunogen
- CDH16 antibody was raised using the N terminal of CDH16 corresponding to a region with amino acids SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD
- Top Product
- Discover our top product CDH16 Primärantikörper
-
anti-Cadherin-16 (CDH16) (AA 37-287) antibody
CDH16 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Cadherin-16 (CDH16) (AA 353-617) antibodyCDH16 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Cadherin-16 (CDH16) antibodyCDH16 Reaktivität: Human, Maus, Ratte IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Cadherin-16 (CDH16) antibodyCDH16 Reaktivität: Human WB, FACS, IHC (f) Wirt: Kaninchen Monoclonal CDH16-1532R unconjugated Recombinant Antibody
anti-Cadherin-16 (CDH16) antibodyCDH16 Reaktivität: Human WB, FACS, ELISA, IHC (f), Coat Wirt: Maus Monoclonal CDH16-1071 unconjugated
anti-Cadherin-16 (CDH16) (AA 19-230) antibodyCDH16 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Cadherin-16 (CDH16) (AA 371-507) antibodyCDH16 Reaktivität: Human WB, ELISA, IHC (f), Coat Wirt: Maus Monoclonal CDH16-2125 unconjugated
anti-Cadherin-16 (CDH16) (AA 371-507) antibody (Biotin)CDH16 Reaktivität: Human WB, ELISA, IHC (f), Coat Wirt: Maus Monoclonal Biotin
anti-Cadherin-16 (CDH16) (AA 371-507) antibodyCDH16 Reaktivität: Human ELISA, IHC (f), Coat Wirt: Maus Monoclonal CDH16-2448 unconjugated
anti-Cadherin-16 (CDH16) antibodyCDH16 Reaktivität: Human WB, FACS, IHC (f) Wirt: Maus Monoclonal rCDH16-1071 unconjugated Recombinant Antibody
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDH16 Blocking Peptide, catalog no. 33R-8368, is also available for use as a blocking control in assays to test for specificity of this CDH16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cadherin-16 (CDH16)
- Andere Bezeichnung
- CDH16 (CDH16 Produkte)
- Synonyme
- cadherin 16 antikoerper, CDH16 antikoerper, Cdh16 antikoerper
- Hintergrund
- CDH16 is a member of the cadherin superfamily, which are calcium-dependent, membrane-associated glycoproteins. CDH16 consists of an extracellular domain containing 6 cadherin domains, a transmembrane region and a truncated cytoplasmic domain but lacks the prosequence and tripeptide HAV adhesion recognition sequence typical of most classical cadherins. Expression is exclusively in kidney, where the protein functions as the principal mediator of homotypic cellular recognition, playing a role in the morphogenic direction of tissue development.
- Molekulargewicht
- 88 kDa (MW of target protein)
-
