Cadherin-16 Antikörper (N-Term)

Produktnummer ABIN634728

Dieses Anti-Cadherin-16-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Cadherin-16 in WB. Geeignet für Human.

Kurzübersicht für Cadherin-16 Antikörper (N-Term) (ABIN634728)

Target: Cadherin-16 (CDH16)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cadherin-16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Cadherin-16 Antikörper

Bindungsspezifität: N-Term

Spezifität: CDH16 antibody was raised against the N terminal of CDH16

Aufreinigung: Affinity purified

Immunogen: CDH16 antibody was raised using the N terminal of CDH16 corresponding to a region with amino acids SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDH16 Blocking Peptide, catalog no. 33R-8368, is also available for use as a blocking control in assays to test for specificity of this CDH16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cadherin-16

Target: Cadherin-16 (CDH16)

Andere Bezeichnung: CDH16

Hintergrund: CDH16 is a member of the cadherin superfamily, which are calcium-dependent, membrane-associated glycoproteins. CDH16 consists of an extracellular domain containing 6 cadherin domains, a transmembrane region and a truncated cytoplasmic domain but lacks the prosequence and tripeptide HAV adhesion recognition sequence typical of most classical cadherins. Expression is exclusively in kidney, where the protein functions as the principal mediator of homotypic cellular recognition, playing a role in the morphogenic direction of tissue development.

Molekulargewicht: 88 kDa (MW of target protein)