ICAM5 Antikörper (N-Term)

Produktnummer ABIN634713

Dieses Anti-ICAM5-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ICAM5 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ICAM5 Antikörper (N-Term) (ABIN634713)

Target: ICAM5 (Intercellular Adhesion Molecule 5 (ICAM5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ICAM5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ICAM5 Antikörper

Bindungsspezifität: N-Term

Spezifität: ICAM5 antibody was raised against the N terminal of ICAM5

Aufreinigung: Affinity purified

Immunogen: ICAM5 antibody was raised using the N terminal of ICAM5 corresponding to a region with amino acids RRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ICAM5 Blocking Peptide, (ABIN5614130), is also available for use as a blocking control in assays to test for specificity of this ICAM5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICAM5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ICAM5

Target: ICAM5 (Intercellular Adhesion Molecule 5 (ICAM5))

Andere Bezeichnung: ICAM5

Hintergrund: ICAM5 is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is expressed on the surface of telencephalic neurons and displays two types of adhesion activity, homophilic binding between neurons and heterophilic binding between neurons and leukocytes.

Molekulargewicht: 95 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, ER-Nucleus Signaling, Maintenance of Protein Location