Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

DGCR2 Antikörper (Middle Region)

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DGCR2 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.
Produktnummer ABIN634699

Kurzübersicht für DGCR2 Antikörper (Middle Region) (ABIN634699)

Target

Alle DGCR2 (DGS2) Antikörper anzeigen
DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Reaktivität

  • 17
  • 15
  • 7
  • 4
  • 4
  • 3
  • 2
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
Human, Maus, Ratte

Wirt

  • 17
Kaninchen

Klonalität

  • 17
Polyklonal

Konjugat

  • 12
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser DGCR2 Antikörper ist unkonjugiert

Applikation

  • 16
  • 10
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 7
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Middle Region

    Spezifität

    DGCR2 antibody was raised against the middle region of DGCR2

    Aufreinigung

    Affinity purified

    Immunogen

    DGCR2 antibody was raised using the middle region of DGCR2 corresponding to a region with amino acids AESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEP
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    DGCR2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this DGCR2 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR2 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

    Andere Bezeichnung

    DGCR2

    Hintergrund

    Deletions of the 22q11.2 have been associated with a wide range of developmental defects classified under the acronym CATCH 22. The DGCR2 is a novel putative adhesion receptor protein, which could play a role in neural crest cells migration, a process which has been proposed to be altered in DiGeorge syndrome.

    Molekulargewicht

    61 kDa (MW of target protein)
Sie sind hier:
Chat with us!