DGCR2 Antikörper (Middle Region)

Produktnummer ABIN634699

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch DGCR2 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für DGCR2 Antikörper (Middle Region) (ABIN634699)

Target: DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DGCR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DGCR2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: DGCR2 antibody was raised against the middle region of DGCR2

Aufreinigung: Affinity purified

Immunogen: DGCR2 antibody was raised using the middle region of DGCR2 corresponding to a region with amino acids AESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DGCR2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this DGCR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DGCR2

Target: DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Andere Bezeichnung: DGCR2

Hintergrund: Deletions of the 22q11.2 have been associated with a wide range of developmental defects classified under the acronym CATCH 22. The DGCR2 is a novel putative adhesion receptor protein, which could play a role in neural crest cells migration, a process which has been proposed to be altered in DiGeorge syndrome.

Molekulargewicht: 61 kDa (MW of target protein)