DiGeorge Syndrome Chromosome Region-2 (DGS2) (N-Term) Antikörper

Details zu Produkt Nr. ABIN634763
Antigen
Epitop
N-Term
9
8
7
7
3
2
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
31
22
11
4
4
3
2
2
2
2
2
1
Wirt
Kaninchen
32
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
31
20
2
1
1
1
Optionen
Immunogen DGCR2 antibody was raised using the N terminal of DGCR2 corresponding to a region with amino acids MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQ
Spezifität DGCR2 antibody was raised against the N terminal of DGCR2
Reinigung Affinity purified
Antigen
Andere Bezeichnung DGCR2 (DGS2 Antibody Abstract)
Hintergrund DGCR2 is the putative adhesion receptor that could be involved in cell-cell or cell-matrix interactions required for normal cell differentiation and migration.
Molekulargewicht 61 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

DGCR2 Blocking Peptide, catalog no. 33R-6598, is also available for use as a blocking control in assays to test for specificity of this DGCR2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-DiGeorge Syndrome Chromosome Region-2 (DGS2) (N-Term) antibody (ABIN634763) DGCR2 antibody used at 1 ug/ml to detect target protein.