DGCR2 Antikörper (N-Term)

Produktnummer ABIN634763

Produktdetails anti-DGCR2 Antikörper

Target: DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DGCR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DGCR2 antibody was raised against the N terminal of DGCR2

Aufreinigung: Affinity purified

Immunogen: DGCR2 antibody was raised using the N terminal of DGCR2 corresponding to a region with amino acids MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DGCR2 Blocking Peptide, catalog no. 33R-6598, is also available for use as a blocking control in assays to test for specificity of this DGCR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DGCR2

Target: DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Andere Bezeichnung: DGCR2 (DGS2 Produkte)

Synonyme: DGS-C antikoerper, IDD antikoerper, LAN antikoerper, SEZ-12 antikoerper, CIDD antikoerper, 9930034O06Rik antikoerper, Dgsc antikoerper, Idd antikoerper, Lan antikoerper, Sez12 antikoerper, mKIAA0163 antikoerper, zgc:91974 antikoerper, DiGeorge syndrome critical region gene 2 antikoerper, DiGeorge syndrome critical region gene 2 S homeolog antikoerper, DGCR2 antikoerper, Dgcr2 antikoerper, dgcr2 antikoerper, dgcr2.S antikoerper

Hintergrund: DGCR2 is the putative adhesion receptor that could be involved in cell-cell or cell-matrix interactions required for normal cell differentiation and migration.

Molekulargewicht: 61 kDa (MW of target protein)