KIT Ligand Antikörper (Middle Region)

Produktnummer ABIN634669

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch KIT Ligand in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für KIT Ligand Antikörper (Middle Region) (ABIN634669)

Target: KIT Ligand (KITLG)

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIT Ligand Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KIT Ligand Antikörper

Bindungsspezifität: Middle Region

Spezifität: KITLG antibody was raised against the middle region of KITLG

Aufreinigung: Affinity purified

Immunogen: KITLG antibody was raised using the middle region of KITLG corresponding to a region with amino acids TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KITLG Blocking Peptide, (ABIN5614363), is also available for use as a blocking control in assays to test for specificity of this KITLG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KITLG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIT Ligand

Target: KIT Ligand (KITLG)

Andere Bezeichnung: KITLG

Hintergrund: KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung