KIT Ligand Antikörper (Middle Region)

Produktnummer ABIN634669

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch KIT Ligand in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für KIT Ligand Antikörper (Middle Region) (ABIN634669)

Target: KIT Ligand (KITLG)

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIT Ligand Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KIT Ligand Antikörper

Bindungsspezifität: Middle Region

Spezifität: KITLG antibody was raised against the middle region of KITLG

Aufreinigung: Affinity purified

Immunogen: KITLG antibody was raised using the middle region of KITLG corresponding to a region with amino acids TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KITLG Blocking Peptide, (ABIN5614363), is also available for use as a blocking control in assays to test for specificity of this KITLG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KITLG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIT Ligand

Target: KIT Ligand (KITLG)

Andere Bezeichnung: KITLG

Hintergrund: KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung