CD40 Ligand Antikörper

Produktnummer ABIN634665

Dieser Anti-CD40 Ligand-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von CD40 Ligand in WB. Geeignet für Human.

Kurzübersicht für CD40 Ligand Antikörper (ABIN634665)

Target: CD40 Ligand (CD40LG)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CD40 Ligand Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CD40 Ligand Antikörper

Aufreinigung: Affinity purified

Immunogen: CD40 L antibody was raised using a synthetic peptide corresponding to a region with amino acids ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CD40L Blocking Peptide, (ABIN938001), is also available for use as a blocking control in assays to test for specificity of this CD40L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD40 G antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CD40 Ligand

Target: CD40 Ligand (CD40LG)

Andere Bezeichnung: CD40L

Hintergrund: CD40LG is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: NF-kappaB Signalweg, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints