CD40 Ligand Antikörper
-
- Target Alle CD40 Ligand (CD40LG) Antikörper anzeigen
- CD40 Ligand (CD40LG)
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CD40 Ligand Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CD40 L antibody was raised using a synthetic peptide corresponding to a region with amino acids ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN
- Top Product
- Discover our top product CD40LG Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CD40L Blocking Peptide, catalog no. 33R-2615, is also available for use as a blocking control in assays to test for specificity of this CD40L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD40 G antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CD40 Ligand (CD40LG)
- Andere Bezeichnung
- CD40L (CD40LG Produkte)
- Hintergrund
- CD40LG is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.
- Molekulargewicht
- 29 kDa (MW of target protein)
- Pathways
- NF-kappaB Signalweg, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints
-