ATP2C1 Antikörper (C-Term)
-
- Target Alle ATP2C1 Antikörper anzeigen
- ATP2C1 (ATPase, Ca++ Transporting, Type 2C, Member 1 (ATP2C1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATP2C1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ATP2 C1 antibody was raised against the C terminal of ATP2 1
- Aufreinigung
- Affinity purified
- Immunogen
- ATP2 C1 antibody was raised using the C terminal of ATP2 1 corresponding to a region with amino acids TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILGLA
- Top Product
- Discover our top product ATP2C1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ATP2C1 Blocking Peptide, catalog no. 33R-9151, is also available for use as a blocking control in assays to test for specificity of this ATP2C1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP2C1 (ATPase, Ca++ Transporting, Type 2C, Member 1 (ATP2C1))
- Andere Bezeichnung
- ATP2C1 (ATP2C1 Produkte)
- Hintergrund
- ATP2C1 belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Molekulargewicht
- 98 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Ribonucleoside Biosynthetic Process
-