TIRAP Antikörper

Produktnummer ABIN634400

Der Kaninchen Polyklonal anti-TIRAP Antikörper wird verwendet zum Nachweis von TIRAP in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für TIRAP Antikörper (ABIN634400)

Target: TIRAP (Toll-Interleukin 1 Receptor (TIR) Domain Containing Adaptor Protein (TIRAP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TIRAP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TIRAP Antikörper

Aufreinigung: Affinity purified

Immunogen: TIRAP antibody was raised using a synthetic peptide corresponding to a region with amino acids LEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TIRAP Blocking Peptide, (ABIN940287), is also available for use as a blocking control in assays to test for specificity of this TIRAP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIRAP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TIRAP

Target: TIRAP (Toll-Interleukin 1 Receptor (TIR) Domain Containing Adaptor Protein (TIRAP))

Andere Bezeichnung: TIRAP

Hintergrund: The innate immune system recognises microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: TLR Signalweg, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades