TAB1 Antikörper (N-Term)

Produktnummer ABIN634348

Produktdetails anti-TAB1 Antikörper

Target: TAB1 (TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 1 (TAB1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TAB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAP3 K3 P1 antibody was raised against the N terminal of MAP3 3 P1

Aufreinigung: Affinity purified

Immunogen: MAP3 K3 P1 antibody was raised using the N terminal of MAP3 3 P1 corresponding to a region with amino acids MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAP3K7IP1 Blocking Peptide, catalog no. 33R-5608, is also available for use as a blocking control in assays to test for specificity of this MAP3K7IP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 0 P1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TAB1

Target: TAB1 (TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 1 (TAB1))

Andere Bezeichnung: MAP3K7IP1 (TAB1 Produkte)

Synonyme: 3'-Tab1 antikoerper, MAP3K7IP1 antikoerper, 2310012M03Rik antikoerper, Map3k7ip1 antikoerper, b2b449Clo antikoerper, TGF-beta activated kinase 1 (MAP3K7) binding protein 1 antikoerper, TGF-beta activated kinase 1/MAP3K7 binding protein 1 antikoerper, TAB1 antikoerper, Tab1 antikoerper

Hintergrund: The protein encoded by this gene was identified as a regulator of the MAP kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: TLR Signalweg, Fc-epsilon Rezeptor Signalübertragung, Activation of Innate immune Response, Toll-Like Receptors Cascades