SOD2 Antikörper (N-Term)

Produktnummer ABIN634322

Produktdetails anti-SOD2 Antikörper

Target: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SOD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SOD2 antibody was raised against the N terminal of SOD2

Aufreinigung: Affinity purified

Immunogen: SOD2 antibody was raised using the N terminal of SOD2 corresponding to a region with amino acids MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SOD2 Blocking Peptide, catalog no. 33R-6219, is also available for use as a blocking control in assays to test for specificity of this SOD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SOD2

Target: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Andere Bezeichnung: SOD2 (SOD2 Produkte)

Synonyme: LOC100101896 antikoerper, MNSOD antikoerper, GB14346 antikoerper, sod2 antikoerper, MGC88869 antikoerper, Sod2 antikoerper, CG8905 antikoerper, Dmel\\CG8905 antikoerper, Mito SOD antikoerper, Mn SOD antikoerper, Mn-SOD antikoerper, Mn-SOD2 antikoerper, MnSOD antikoerper, MnSODII antikoerper, Mn[2+]SOD antikoerper, SOD antikoerper, SOD-2 antikoerper, SOD2 antikoerper, Sod-2 antikoerper, dSOD2 antikoerper, mitSOD2 antikoerper, mnSOD antikoerper, IPOB antikoerper, MVCD6 antikoerper, cb463 antikoerper, wu:fj33b01 antikoerper, zgc:73051 antikoerper, MnSOD antikoerper, manganese superoxide dismutase antikoerper, superoxide dismutase 2, mitochondrial antikoerper, superoxide dismutase 2 antikoerper, Mn superoxide dismutase antikoerper, Superoxide dismutase 2 (Mn) antikoerper, superoxide dismutase 2 L homeolog antikoerper, BDBG_07234 antikoerper, LOC100101896 antikoerper, MNSOD antikoerper, Sod2 antikoerper, sod2 antikoerper, LbMnSOD4 antikoerper, SOD2 antikoerper, LOC100282741 antikoerper, SOD-2 antikoerper, sod2.L antikoerper

Hintergrund: SOD2 is a member of the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene encoding SOD2 have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis, Negative Regulation of intrinsic apoptotic Signaling