SOD2 Antikörper (C-Term)
-
- Target Alle SOD2 Antikörper anzeigen
- SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))
-
Bindungsspezifität
- AA 192-222, C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SOD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Superoxide dismutase [Mn], mitochondrial(SOD2) detection. Tested with WB, IHC-P in Human,Mouse.
- Sequenz
- QYKNVRPDYL KAIWNVINWE NVTERYMACK K
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Superoxide dismutase [Mn], mitochondrial(SOD2) detection. Tested with WB, IHC-P in Human,Mouse.
Gene Name: superoxide dismutase 2, mitochondrial
Protein Name: Superoxide dismutase [Mn], mitochondrial - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human SOD2 (192-222aa QYKNVRPDYLKAIWNVINWENVTERYMACKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by four amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product SOD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, The detection limit for SOD2 is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Maternal inflammation activated ROS-p38 MAPK predisposes offspring to heart damages caused by isoproterenol via augmenting ROS generation." in: Scientific reports, Vol. 6, pp. 30146, (2018) (PubMed).
: "
-
Maternal inflammation activated ROS-p38 MAPK predisposes offspring to heart damages caused by isoproterenol via augmenting ROS generation." in: Scientific reports, Vol. 6, pp. 30146, (2018) (PubMed).
-
- Target
- SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))
- Andere Bezeichnung
- SOD2 (SOD2 Produkte)
- Synonyme
- LOC100101896 antikoerper, MNSOD antikoerper, GB14346 antikoerper, sod2 antikoerper, MGC88869 antikoerper, Sod2 antikoerper, CG8905 antikoerper, Dmel\\CG8905 antikoerper, Mito SOD antikoerper, Mn SOD antikoerper, Mn-SOD antikoerper, Mn-SOD2 antikoerper, MnSOD antikoerper, MnSODII antikoerper, Mn[2+]SOD antikoerper, SOD antikoerper, SOD-2 antikoerper, SOD2 antikoerper, Sod-2 antikoerper, dSOD2 antikoerper, mitSOD2 antikoerper, mnSOD antikoerper, IPOB antikoerper, MVCD6 antikoerper, cb463 antikoerper, wu:fj33b01 antikoerper, zgc:73051 antikoerper, MnSOD antikoerper, manganese superoxide dismutase antikoerper, superoxide dismutase 2, mitochondrial antikoerper, superoxide dismutase 2 antikoerper, Mn superoxide dismutase antikoerper, Superoxide dismutase 2 (Mn) antikoerper, superoxide dismutase 2 L homeolog antikoerper, BDBG_07234 antikoerper, LOC100101896 antikoerper, MNSOD antikoerper, Sod2 antikoerper, sod2 antikoerper, LbMnSOD4 antikoerper, SOD2 antikoerper, LOC100282741 antikoerper, SOD-2 antikoerper, sod2.L antikoerper
- Hintergrund
-
SOD2(Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Using a somatic cell hybrid panel containing different segments of chromosome 6, they demonstrated that SOD2 is located in the region 6q25.3-qter which, together with the FISH analysis, indicated that SOD2 is in the distal portion of 6q25. The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation. Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells. The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, and that expression of SOD2 attenuated the disease process.
Synonyms: Indophenoloxidase B antibody|IPO B antibody|IPOB antibody|Manganese containing superoxide dismutase antibody|Manganese SOD antibody|Manganese superoxide dismutase antibody|Mangano superoxide dismutase antibody|Mn SOD antibody|Mn superoxide dismutase antibody|MNSOD antibody|MVCD6 antibody|SOD 2 antibody|SOD-2 antibody|SOD2 antibody|SODM_HUMAN antibody| Superoxide dismutase [Mn] mitochondrial antibody|Superoxide dismutase [Mn] mitochondrial precursor antibody|Superoxide dismutase [Mn], mitochondrial antibody|Superoxide dismutase 2 mitochondrial antibody - Gen-ID
- 6648
- UniProt
- P04179
- Pathways
- Sensory Perception of Sound, Transition Metal Ion Homeostasis, Negative Regulation of intrinsic apoptotic Signaling
-