TBK1 Antikörper (N-Term)

Produktnummer ABIN634305

Produktdetails anti-TBK1 Antikörper

Target: TBK1 (TANK-Binding Kinase 1 (TBK1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TBK1 antibody was raised against the N terminal of TBK1

Aufreinigung: Affinity purified

Immunogen: TBK1 antibody was raised using the N terminal of TBK1 corresponding to a region with amino acids EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBK1 Blocking Peptide, catalog no. 33R-2352, is also available for use as a blocking control in assays to test for specificity of this TBK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBK1

Target: TBK1 (TANK-Binding Kinase 1 (TBK1))

Andere Bezeichnung: TBK1 (TBK1 Produkte)

Synonyme: nak antikoerper, t2k antikoerper, TBK1 antikoerper, wu:fk70c05 antikoerper, zgc:136548 antikoerper, NAK antikoerper, T2K antikoerper, 1200008B05Rik antikoerper, AI462036 antikoerper, AW048562 antikoerper, TANK binding kinase 1 L homeolog antikoerper, TANK binding kinase 1 antikoerper, TANK-binding kinase 1 antikoerper, tbk1.L antikoerper, TBK1 antikoerper, tbk1 antikoerper, Tbk1 antikoerper

Hintergrund: The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. TBK1 is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. For example, the protein can form a complex with the IKB protein TANK and TRAF2 and release the NFKB inhibition caused by TANK.

Molekulargewicht: 84 kDa (MW of target protein)

Pathways: TLR Signalweg, Activation of Innate immune Response, Hepatitis C, Toll-Like Receptors Cascades, SARS-CoV-2 Protein Interaktom