GNAQ Antikörper

Produktnummer ABIN634295

Produktdetails anti-GNAQ Antikörper

Target: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNAQ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GNAQ antibody was raised using a synthetic peptide corresponding to a region with amino acids DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNAQ Blocking Peptide, catalog no. 33R-2030, is also available for use as a blocking control in assays to test for specificity of this GNAQ antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAQ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNAQ

Target: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Andere Bezeichnung: GNAQ (GNAQ Produkte)

Synonyme: si:ch73-270f14.2 antikoerper, CMC1 antikoerper, G-ALPHA-q antikoerper, GAQ antikoerper, SWS antikoerper, Galphaq antikoerper, Gnaq antikoerper, g-alpha-q antikoerper, gaq antikoerper, gnaqb antikoerper, 1110005L02Rik antikoerper, 6230401I02Rik antikoerper, AA408290 antikoerper, AW060788 antikoerper, Dsk1 antikoerper, Dsk10 antikoerper, Gq antikoerper, GqI antikoerper, guanine nucleotide binding protein (G protein), q polypeptide antikoerper, G protein subunit alpha q antikoerper, guanine nucleotide binding protein (G protein), q polypeptide S homeolog antikoerper, guanine nucleotide binding protein, alpha q polypeptide antikoerper, gnaq antikoerper, GNAQ antikoerper, Gnaq antikoerper, gnaq.S antikoerper

Hintergrund: Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction