GNAQ Antikörper

Produktnummer ABIN634295

Der Kaninchen Polyklonal Anti-GNAQ-Antikörper wurde für WB validiert. Er ist geeignet, GNAQ in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für GNAQ Antikörper (ABIN634295)

Target: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNAQ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GNAQ Antikörper

Aufreinigung: Affinity purified

Immunogen: GNAQ antibody was raised using a synthetic peptide corresponding to a region with amino acids DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNAQ Blocking Peptide, (ABIN937416), is also available for use as a blocking control in assays to test for specificity of this GNAQ antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAQ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNAQ

Target: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Andere Bezeichnung: GNAQ

Hintergrund: Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction