MAPK12 Antikörper (N-Term)

Produktnummer ABIN634255

Produktdetails anti-MAPK12 Antikörper

Target: MAPK12 (Mitogen-Activated Protein Kinase 12 (MAPK12))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAPK12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAPK12 antibody was raised against the N terminal of MAPK12

Aufreinigung: Affinity purified

Immunogen: MAPK12 antibody was raised using the N terminal of MAPK12 corresponding to a region with amino acids SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAPK12 Blocking Peptide, catalog no. 33R-8447, is also available for use as a blocking control in assays to test for specificity of this MAPK12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAPK12

Target: MAPK12 (Mitogen-Activated Protein Kinase 12 (MAPK12))

Andere Bezeichnung: MAPK12 (MAPK12 Produkte)

Synonyme: ATMPK12 antikoerper, MAPK12 antikoerper, T3F17.28 antikoerper, mitogen-activated protein kinase 12 antikoerper, MGC160082 antikoerper, si:dkey-14d8.5 antikoerper, erk6 antikoerper, etID309866.18 antikoerper, mapk12 antikoerper, sapk3 antikoerper, wu:fa05c12 antikoerper, zgc:101695 antikoerper, ERK3 antikoerper, ERK6 antikoerper, P38GAMMA antikoerper, PRKM12 antikoerper, SAPK-3 antikoerper, SAPK3 antikoerper, AW123708 antikoerper, Erk6 antikoerper, P38gamma antikoerper, Prkm12 antikoerper, Sapk3 antikoerper, mitogen-activated protein kinase 12 antikoerper, mitogen-activated protein kinase 12b antikoerper, mitogen-activated protein kinase 12a antikoerper, MPK12 antikoerper, MAPK12 antikoerper, mapk12b antikoerper, mapk12a antikoerper, Mapk12 antikoerper

Hintergrund: Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: MAPK Signalweg, Neurotrophin Signalübertragung, Regulation of Muscle Cell Differentiation, Hepatitis C, BCR Signaling, S100 Proteine