MAPK12 Antikörper (N-Term)

Produktnummer ABIN634255

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MAPK12 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für MAPK12 Antikörper (N-Term) (ABIN634255)

Target: MAPK12 (Mitogen-Activated Protein Kinase 12 (MAPK12))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAPK12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MAPK12 Antikörper

Bindungsspezifität: N-Term

Spezifität: MAPK12 antibody was raised against the N terminal of MAPK12

Aufreinigung: Affinity purified

Immunogen: MAPK12 antibody was raised using the N terminal of MAPK12 corresponding to a region with amino acids SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAPK12 Blocking Peptide, (ABIN5614663), is also available for use as a blocking control in assays to test for specificity of this MAPK12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAPK12

Target: MAPK12 (Mitogen-Activated Protein Kinase 12 (MAPK12))

Andere Bezeichnung: MAPK12

Hintergrund: Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: MAPK Signalweg, Neurotrophin Signalübertragung, Regulation of Muscle Cell Differentiation, Hepatitis C, BCR Signaling, S100 Proteine