PARD3 Antikörper

Produktnummer ABIN634251

Dieser Anti-PARD3 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von PARD3 in WB. Geeignet für Human.

Kurzübersicht für PARD3 Antikörper (ABIN634251)

Target: PARD3 (Par-3 Partitioning Defective 3 Homolog (PARD3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PARD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PARD3 Antikörper

Aufreinigung: Affinity purified

Immunogen: PARD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PARD3 Blocking Peptide, (ABIN938061), is also available for use as a blocking control in assays to test for specificity of this PARD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PARD3

Target: PARD3 (Par-3 Partitioning Defective 3 Homolog (PARD3))

Andere Bezeichnung: PARD3

Hintergrund: PARD proteins, which were first identified in C. elegans, are essential for asymmetric cell division and polarized growth, whereas CDC42 mediates the establishment of cell polarity. The CDC42 GTPase, which is controlled by nucleotide exchange.

Molekulargewicht: 151 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization