PARD3 Antikörper
-
- Target Alle PARD3 Antikörper anzeigen
- PARD3 (Par-3 Partitioning Defective 3 Homolog (PARD3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PARD3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PARD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNR
- Top Product
- Discover our top product PARD3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PARD3 Blocking Peptide, catalog no. 33R-2675, is also available for use as a blocking control in assays to test for specificity of this PARD3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARD3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARD3 (Par-3 Partitioning Defective 3 Homolog (PARD3))
- Andere Bezeichnung
- PARD3 (PARD3 Produkte)
- Hintergrund
- PARD proteins, which were first identified in C. elegans, are essential for asymmetric cell division and polarized growth, whereas CDC42 mediates the establishment of cell polarity. The CDC42 GTPase, which is controlled by nucleotide exchange.
- Molekulargewicht
- 151 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-