MAPK13 Antikörper (Middle Region)

Produktnummer ABIN634241

Der Kaninchen Polyklonal anti-MAPK13 Antikörper wird verwendet zum Nachweis von MAPK13 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für MAPK13 Antikörper (Middle Region) (ABIN634241)

Target: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAPK13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MAPK13 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MAPK13 antibody was raised against the middle region of MAPK13

Aufreinigung: Affinity purified

Immunogen: MAPK13 antibody was raised using the middle region of MAPK13 corresponding to a region with amino acids KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAPK13 Blocking Peptide, (ABIN939944), is also available for use as a blocking control in assays to test for specificity of this MAPK13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAPK13

Target: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Andere Bezeichnung: MAPK13

Hintergrund: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation and transcription.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: MAPK Signalweg, Neurotrophin Signalübertragung, Hepatitis C, BCR Signaling, S100 Proteine